Domain Search
Domain Generator
WHOIS Information
Reverse IP Lookup
Domain Location
DNS Lookup
Blocklist Lookup
Open Ports Lookup
WHOIS Information
Domain Name: SIMPLICITYFINANCIALSERVICES.NET Registry Domain ID: 2876978918_DOMAIN_NET-VRSN Registrar WHOIS Server: whois.squarespace.domains Registrar URL: http://domains2.squarespace.com Updated Date: 2024-06-06T09:34:52Z Creation Date: 2024-04-30T00:08:48Z Registry Expiry Date: 2025-04-30T00:08:48Z Registrar: Squarespace Domains II LLC Registrar IANA ID: 895 Registrar Abuse Contact Email: abuse-complaints@squarespace.com Registrar Abuse Contact Phone: +1.6466935324 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: NS-CLOUD-D1.GOOGLEDOMAINS.COM Name Server: NS-CLOUD-D2.GOOGLEDOMAINS.COM Name Server: NS-CLOUD-D3.GOOGLEDOMAINS.COM Name Server: NS-CLOUD-D4.GOOGLEDOMAINS.COM DNSSEC: signedDelegation DNSSEC DS Data: 35944 8 2 E0D14AA797FF24F81829CEC865A80274A6A91617314C9ABE50AB105792373757 URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2025-01-31T08:47:40Z <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.
Check Domain Availability
Check Domain Availability

Check whether a Domain Name is available for registration or not via our Domain Search Tool.

Find Domain Owner & Information
Find Domain Owner Information

Use the WHOIS Information tool to find out a domains owner, location, ip and other information.

Find out Domain Expiry
Find out Domain Expiry

Looking out for a domain name that you want to claim? Learn when a domain will expire with our whois & search tools.

FAQS

How do I search a domain name?

Simply use the Domain Search tool above. Type in the domain name in the search box and click on "Search"

How do I generate domain names?

Use the Domain Generator tool. Type in a key-word and you will receive many suggestions back.

How can I find out who owns a domain?

You can find out a domains ownership using the WHOIS Information tool above.

Where can I find when a domain expires?

You can use the WHOIS Information tool and check the domain-name to see when it will expire.

How do I find the location of an IP or Domain?

To find the Location of an IP / Domain, you can use the IP Lookup & Domain Location tools.

Where can I see the DNS Records of a Domain?

Use the DNS Lookup tool and type in your Domain Name.